- Recombinant Human coronavirus 229E Non-structural protein 4a (4a)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1123643
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 15,299 Da
- E Coli or Yeast
- 22-133
- Non-structural protein 4a (4a)
Sequence
KVSAEVSRQVIQDVKDGTVTFNLLAYTLMSLFVVYFALFKARSHRGRAALIVFKILILFVYVPLLYWSQAYIYATLIAVILLGRFFHTAWHCWLYKTWDFIVFNVTTLCYAR